Tissue & recovery
TB-500 Price Comparison
Also referred to as: Thymosin beta-4 fragment · Tβ4 fragment · Thymosin Beta-4 Fragment (TB-500) · Ac-LKKTETQ
UK supplier comparison
Use the filters to pick a size and presentation (vial, pen or serum) and compare like for like, or view every size on a £ per mg basis. Delivery is shown separately because it varies by supplier and order size. Offers whose outbound link failed our last check stay listed but rank below working links.
No live listings for TB-500 yet
Suppliers are being onboarded. This comparison will populate as listings go live. Everything below — the research profile, molecular facts and guides — is available now.
For in-vitro laboratory research only
TB-500 is listed here as a research material. It is not for human or veterinary consumption, and nothing on this page is medical advice or dosing guidance. PeptideCompare is paid by flat supplier fees — never by sales commission or referral — so a price ranks by its number, not by who pays. We do not sell, test or verify any product, and quality or CoA labels are suppliers’ own claims. Always check the final price, documentation and legality with the supplier yourself.
Research profile
About TB-500 in the lab
Thymosin beta-4 is an abundant actin-sequestering protein. Fragments and analogues are used in cytoskeleton, wound-closure and cell-motility research. Because 'TB-500' is used inconsistently, researchers should confirm exact sequence and mass on documentation.
Proposed mechanism
Built around the LKKTETQ actin-binding motif of thymosin beta-4. It sequesters G-actin, which influences cytoskeletal remodelling, cell migration and angiogenesis in culture and animal models.
Structure note
Commonly described as a synthetic analogue of the actin-binding domain of thymosin beta-4 (a 43-residue protein, ≈ 4.96 kDa). Definitions vary between suppliers, so check the stated sequence on the CoA.
Amino-acid sequence (one-letter)
?SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Typical research themes
- Actin dynamics
- Cell motility
- Scratch-assay models
- Sequence identity verification
This profile is a short, general summary of publicly discussed science. It is not exhaustive, not peer-reviewed by PeptideCompare, and is not medical advice. PeptideCompare provides no dosing, protocol or usage guidance — nothing here is for human or veterinary use.
More ways to compare
- Compare all peptide prices →Every UK research peptide, priced side by side.
- More in Tissue & recovery →Browse related compounds and vial sizes.
- Supplier directory →Ranked by Reliability Score (moderated feedback, link health, documentation).
- Buy peptides UK →How to compare UK research-peptide suppliers before you click through.
- Cheap peptides UK →Compare on £ per mg, and why the lowest headline price isn’t always the best value.
- Pure peptides UK →What purity, HPLC and mass-spec claims mean — and what to ask a supplier for.
Related in Tissue & recovery
ARA-290
Non-erythropoietic EPO-derived peptide researched for tissue-protective signalling.
No live listings yet
View profile→
B7-33
Single-chain relaxin-2 analogue studied in fibrosis research.
No live listings yet
View profile→
BPC-157
Gastric-protein-derived pentadecapeptide, one of the most-studied repair peptides in preclinical work.
No live listings yet
View profile→