GLP-1 & metabolic
Retatrutide Price Comparison
Also referred to as: LY3437943 · Triple agonist · Retatrutide (GLP-1/GIP/Glucagon receptor tri-agonist) · Triple GLP-1/GIP/Glucagon Agonist
Lowest in stock£1.00/mg· Peptides Kent
UK supplier comparison
Use the filters to pick a size and presentation (vial, pen or serum) and compare like for like, or view every size on a £ per mg basis. Delivery is shown separately because it varies by supplier and order size. Offers whose outbound link failed our last check stay listed but rank below working links.
- Best price
- £1.00/mg
- Average
- £2.20/mg
- Highest
- £3.33/mg
- You could save
- 70%
lowest in stock, working link
across 5 in-stock offers
highest in stock
best vs highest
Showing normalised £ per mg across all sizes. Sorted: lowest £/mg first. Stats use in-stock offers only.
| Supplier | Size | Price | £ / mg | Stock | Link health | Delivery | Quality (claimed) | Visit |
|---|---|---|---|---|---|---|---|---|
 Peptides KentLowest United Kingdom | 60 mg vial | £60.00 | £1.00 | In stock Checked 2026-10-23 | Link OK | Free UK | Visit Peptides Kent | |
 United Kingdom | 30 mg vial | £50.00 | £1.67 | In stock Checked 2026-10-23 | Link OK | Free UK | Visit Peptides Kent | |
 United Kingdom | 60 mg pen | £120.00 | £2.00 | In stock Checked 2026-10-23 | Link OK | Free UK | Visit Peptides Kent | |
 United Kingdom | 10 mg vial | £30.00 | £3.00 | In stock Checked 2026-10-23 | Link OK | Free UK | Visit Peptides Kent | |
 United Kingdom | 30 mg pen | £100.00 | £3.33 | In stock Checked 2026-10-23 | Link OK | Free UK | Visit Peptides Kent |
Prices are set by independent suppliers and may change. Quality and CoA labels are self-reported claims — not verified by PeptideCompare. PeptideCompare does not sell or supply products and cannot vouch for quality, legality or availability. For in-vitro research only — not for human or veterinary use.
For in-vitro laboratory research only
Retatrutide is listed here as a research material. It is not for human or veterinary consumption, and nothing on this page is medical advice or dosing guidance. PeptideCompare is paid by flat supplier fees — never by sales commission or referral — so a price ranks by its number, not by who pays. We do not sell, test or verify any product, and quality or CoA labels are suppliers’ own claims. Always check the final price, documentation and legality with the supplier yourself.
Research profile
About Retatrutide in the lab
An investigational molecule designed to act on three related class-B GPCRs. Laboratory work centres on comparative receptor pharmacology and analytical characterisation.
Proposed mechanism
A single acylated peptide that activates GIP, GLP-1 and glucagon receptors. The incretin components affect insulin secretion and satiety, while glucagon-receptor activity raises energy expenditure and hepatic fat oxidation in models.
Structure note
Engineered 39-residue backbone with non-natural amino acids and a fatty-diacid side chain; published masses vary slightly by source.
Amino-acid sequence (one-letter)
HUEGTFTSDVSSYLEGQAAKEFIAWLVRGRGPSSGAPPPS
Typical research themes
- Multi-receptor pharmacology
- Class B GPCR assays
- Mass-spectrometry characterisation
Regulatory note
This is an investigational compound with no marketing authorisation. Research-grade material is not for human or veterinary use.
Key references
- Triple-Hormone-Receptor Agonist Retatrutide for Obesity - A Phase 2 Trial. · The New England journal of medicine (2023)
This profile is a short, general summary of publicly discussed science. It is not exhaustive, not peer-reviewed by PeptideCompare, and is not medical advice. PeptideCompare provides no dosing, protocol or usage guidance — nothing here is for human or veterinary use.
More ways to compare
- Compare all peptide prices →Every UK research peptide, priced side by side.
- More in GLP-1 & metabolic →Browse related compounds and vial sizes.
- Supplier directory →Ranked by Reliability Score (moderated feedback, link health, documentation).
- Buy peptides UK →How to compare UK research-peptide suppliers before you click through.
- Cheap peptides UK →Compare on £ per mg, and why the lowest headline price isn’t always the best value.
- Pure peptides UK →What purity, HPLC and mass-spec claims mean — and what to ask a supplier for.
Related in GLP-1 & metabolic
5-Amino 1MQ
Small-molecule NNMT inhibitor studied in cellular metabolism and NAD+ research.
No live listings yet
View profile→
Adipotide
Peptidomimetic targeting adipose vasculature in preclinical obesity research.
No live listings yet
View profile→
Aicar
AMPK-activating nucleoside used widely as a metabolic research tool.
No live listings yet
View profile→