Growth hormone axis
Tesamorelin Price Comparison
Also referred to as: TH9507 · Tesamorelin (Growth Hormone-Releasing Factor Analogue · Egrifta SV · Egrifta WR · GHRH Analog
UK supplier comparison
Use the filters to pick a size and presentation (vial, pen or serum) and compare like for like, or view every size on a £ per mg basis. Delivery is shown separately because it varies by supplier and order size. Offers whose outbound link failed our last check stay listed but rank below working links.
No live listings for Tesamorelin yet
Suppliers are being onboarded. This comparison will populate as listings go live. Everything below — the research profile, molecular facts and guides — is available now.
For in-vitro laboratory research only
Tesamorelin is listed here as a research material. It is not for human or veterinary consumption, and nothing on this page is medical advice or dosing guidance. PeptideCompare is paid by flat supplier fees — never by sales commission or referral — so a price ranks by its number, not by who pays. We do not sell, test or verify any product, and quality or CoA labels are suppliers’ own claims. Always check the final price, documentation and legality with the supplier yourself.
Research profile
About Tesamorelin in the lab
A larger GHRH analogue whose N-terminal modification is of interest in medicinal chemistry for protecting peptides from exopeptidases.
Proposed mechanism
Full 44-amino-acid GHRH sequence with a trans-3-hexenoyl group at the N-terminus that resists DPP-4. It binds pituitary GHRH receptors to raise GH and downstream IGF-1.
Structure note
Full-length GHRH sequence with an N-terminal trans-3-hexenoyl group to resist cleavage.
Amino-acid sequence (one-letter)
HADGIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Typical research themes
- N-terminal modification chemistry
- GHRH receptor binding
- HPLC method development
Regulatory note
The same active substance is a licensed prescription medicine in some countries. Research-grade material is not a medicine and must never be used on people or animals.
This profile is a short, general summary of publicly discussed science. It is not exhaustive, not peer-reviewed by PeptideCompare, and is not medical advice. PeptideCompare provides no dosing, protocol or usage guidance — nothing here is for human or veterinary use.
More ways to compare
- Compare all peptide prices →Every UK research peptide, priced side by side.
- More in Growth hormone axis →Browse related compounds and vial sizes.
- Supplier directory →Ranked by Reliability Score (moderated feedback, link health, documentation).
- Buy peptides UK →How to compare UK research-peptide suppliers before you click through.
- Cheap peptides UK →Compare on £ per mg, and why the lowest headline price isn’t always the best value.
- Pure peptides UK →What purity, HPLC and mass-spec claims mean — and what to ask a supplier for.
Related in Growth hormone axis
ACE-031
Activin receptor type IIB decoy protein from myostatin-pathway research.
No live listings yet
View profile→
ACE-083
Follistatin-based fusion protein researched for localised muscle-pathway effects.
No live listings yet
View profile→
CJC-1295
Short-acting GHRH(1-29) analogue (Mod GRF 1-29) studied in pituitary research.
No live listings yet
View profile→